DPCstruct | MC46262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 206 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A095A210 | 1-204 | MLSSYLSAFYYEYEASKTFASRCAQYLNIDVKFCGVLGKCTRFQEKEVANLTVKVNRVVESKDNKTSGNSPLPQIIPLSDDVLLNSV… |
| A0A183JNL8 | 161-359 | DPTHTTEDVIQYLMLSSYLSAFYYEYEASKTFASRCAQYLNIDVKFCGVLGKCTRFQEKEVANLTVKVNRVVESKDNKTSGNSPLPQ… |
| A0A0B2W0P1 | 38-237 | None |
| A0A812YZ23 | 294-543 | None |
| A0A0R3SQ92 | 161-377 | None |
| A0A4Z2C676 | 210-398 | None |
| A0A504YYC8 | 194-381 | None |
| A0A0C4EW70 | 235-454 | None |
| A0A7J6PAB1 | 292-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.