DPCstruct | MC46260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 399 |
|---|---|
| Mean domain length (aa) | 244 ± 56 aa |
| Standard deviation of domain lengths | 55.68 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 54.65 |
| Assigned Pfam label(s) | CL0023- CL0277- PF11898- CL0123- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8FF48 | 155-374 | FRLEIDAIGKDRLALPLEARRPGAAGGGPSPAELLAEVIKIVSLLSVDHLFYVPPNRREAAQAAWQPYESSHGDLFFLLNLFNAFQG… |
| G3IPQ9 | 2-168 | AEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFI… |
| U6L7J7 | 27-242 | None |
| A0A1Q9C6E4 | 28-254 | None |
| A0A504X1Y0 | 963-1224 | None |
| A0A7S0MF09 | 5-128 | None |
| A0A194UN98 | 362-715 | None |
| A0A7R9Q8I7 | 326-561 | None |
| H0EL05 | 326-528 | None |
| A0A1Y1N504 | 429-693 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.