DPCstruct | MC46259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 214 |
|---|---|
| Mean domain length (aa) | 180 ± 31 aa |
| Standard deviation of domain lengths | 31.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 11.43 |
| Pfam Score | 86.97 |
| Assigned Pfam label(s) | PF06101- CL0760- PF16909- PF06650 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8FCJ1 | 10-204 | QQQQQQQPLGLTDKEQAELVEAFSLDQDSDTLMKRDPVFIRLSFQLEACTLTLMRAASPLVAAECRRLSLSVESRPKHRSLAISAAV… |
| A0A6P7TUP0 | 50-208 | NSKWKLLNVELQTWLEERWKNKSVQVNLYEQIEADLSKMTMTKPYMGALRRTYSPALWILYRQSVNHKAIHLKIQRLQVDNQLPDAY… |
| B0EQV5 | 446-595 | None |
| A0A820CYV4 | 48-206 | None |
| A0A820BF05 | 179-366 | None |
| A0A6G0XB99 | 260-470 | None |
| A0A7R9UE31 | 522-693 | None |
| A0A446JYC2 | 233-386 | None |
| A0A7S1UK80 | 256-427 | None |
| A0A0D8X9V0 | 45-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.