DPCstruct | MC46253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 156 ± 29 aa |
| Standard deviation of domain lengths | 28.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0UKU3 | 65-247 | WHSVYGKYENGKYDQIFHFIVKSQSEVIETNDQIDTTFLNKHGQALSRAFAEMKPISDSTSIRFNHYIKENDKGNLDVFIFPAFQPN… |
| A0A654AE26 | 15-156 | MIDARARAIAYIVREGAKPCAPKSFNSVVIPPATADAPIDVYLLTPQTTAEKLPFGGHYRVTVAPDGSAASRAFTRSCIELPRTPPV… |
| A0A2E4G277 | 66-241 | None |
| A0A2H3NSJ8 | 1-113 | None |
| A0A5C8KYQ3 | 7-150 | None |
| A0A2G4FTF1 | 112-294 | None |
| A0A537MJ22 | 184-333 | None |
| A0A0Q4KWM1 | 109-270 | None |
| A0A2R7KUJ2 | 2-127 | None |
| A0A399WTY6 | 29-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.