DPCstruct | MC4625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9KJP4 | 1-94 | TIIKEEERLSSVIAEIDDDVRIIPRGAFIQVPTAEVVKNRSFEGLSVQESAKLCNYMHFREAKRLDLKSLLQRANMDKAIDFMDSIE… |
| A0A034WVG5 | 79-167 | LKEEERLAAIVFIITEECAVCPRGALYKLTDGRVIPNQMFRGLNDLQVENISNYQILRLPRNDLKHNLLKRSDYNYAIDFLDCIADV… |
| A0A812UXI1 | 222-308 | None |
| A0A482SZR5 | 45-140 | None |
| A0A815BJR6 | 52-142 | None |
| G0UR23 | 187-282 | None |
| D2VWI0 | 84-176 | None |
| A0A7R9JEF0 | 154-244 | None |
| F0VH91 | 84-185 | None |
| A0A5A8CDT7 | 139-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.