DPCstruct | MC46249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565BCY1 | 3-77 | TVDDLIETCTTIIWIASALHAAVNFGQYPYAYFHPNRPTVSRRFMPEPSTTEYAELTKNADLAFLKTITPQLQTM |
| A0A7J8UFH0 | 3-75 | TLINLTQACTIIIWIVSAFDAAVNFGQYPYAGYLPNRPTVSHRFMPEPGTEEYDDLENDSNLAFLKTITAQFQ |
| A0A7J9MR81 | 3-75 | None |
| A0A445BI96 | 201-271 | None |
| A0A2U1PP98 | 86-162 | None |
| A0A0A0KGV3 | 383-455 | None |
| A0A7J7L9L3 | 718-798 | None |
| A0A7J9GNT8 | 88-169 | None |
| A0A699HB71 | 166-242 | None |
| A0A2P5AJC6 | 24-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.