DPCstruct | MC46247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 3 aa |
| Standard deviation of domain lengths | 3.18 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 67.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834TV50 | 1-75 | MSFMRGNLLNRTRKLVKGLAQTEPVWLKAMEQAPPATFPRAEGKIQTITLPEDVYVKKFYKKYPDSKYHDAIKYT |
| A0A7J7NXK2 | 1-77 | MSFMRGDLLTRTRKLVQGFAKAKPKWLNSMEEAPPVSVARVSGKIQKASVPEDVYAKKFLQRYPESLHEDSIRITGI |
| A0A438E368 | 1-78 | None |
| A0A453KBF7 | 57-133 | None |
| A0A3L6T266 | 33-109 | None |
| A0A5B6WBV6 | 1-77 | None |
| A0A3L6PGW8 | 38-114 | None |
| A0A2P6PCT6 | 1-66 | None |
| A0A804J521 | 1-77 | None |
| A0A4S8JWS4 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.