DPCstruct | MC46234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 162 ± 35 aa |
| Standard deviation of domain lengths | 35.45 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.03 |
| Pfam Score | 44.44 |
| Assigned Pfam label(s) | PF17914- CL0625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W7TXZ9 | 9-165 | RHGDYRLHTGGDVFIHATREQGRAEGEFQGDKVHLSVHPDHLDRAFAELGPLLFSGDSPIDKWKVTDLAKVDRDSRVAKGAQFTLYI… |
| A0A0P9NLI8 | 49-235 | QDHDSVRNKKDRNLDKYIAESPNAKSFFYRIIPKHERREDEHQGRLTIGVQPEYAAQLTRAMATLIGKESAITHGKVIGPACHGQMT… |
| A0A2H9T3Y7 | 6-184 | None |
| A0A2I1WGW1 | 22-159 | None |
| A0A0W1A4R1 | 850-1014 | None |
| A0A7G4RHI2 | 19-182 | None |
| A0A7G4RKX6 | 146-285 | None |
| R6XYA8 | 37-238 | None |
| A0A0E3V5M1 | 160-291 | None |
| A0A6I7YE13 | 2-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.