DPCstruct | MC4622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 197 ± 35 aa |
| Standard deviation of domain lengths | 34.75 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UV69 | 5-157 | SNEMETKINTYIHKKKTENNESNKKEFIDQNKYKKEMCSRTCPARINRNQQLKLNIIKNEVGPLDRSVTDNDNDNKNGKSKSKDSQN… |
| A0A2C9KFC7 | 13-202 | ASTNIGESTNDSDYCMKRFNPELIQIKAVNEEEVLRRIDAFIRNKRMEVNERNIREFISPVLAESDTSCARTEAIYVHREGEKSHIS… |
| A0A1A9VLZ6 | 1-228 | None |
| A0A1Y1N960 | 30-276 | None |
| A0A2G8L4L9 | 20-207 | None |
| A0A2I4CL89 | 2-213 | None |
| A0A131YSV3 | 42-279 | None |
| A0A7J7KMQ9 | 12-261 | None |
| T1H6T7 | 5-154 | None |
| A0A1L8FAT7 | 101-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.