DPCstruct | MC46215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 187 ± 24 aa |
| Standard deviation of domain lengths | 24.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166C1P3 | 1-195 | MGQYWLLLNVDKRQTGQGVSGKFPEFIFNGHSWLVRLLARPGPEFNEPVPAYYVSPPSSDKTELGSLSRIPMELIAAIFSSISSSDD… |
| A0A2G8SV41 | 35-177 | NPQYWYIANVDTKELSYENFGVLGDWFYNKHVELFRSIYLPCLPSEYDSWCADYTPQSSALFALPPEVLSLLFAALRDLPHVIALAI… |
| A0A4V3XFR1 | 1-219 | None |
| A0A6A4H9N4 | 3-182 | None |
| A0A2G5B0L6 | 1-174 | None |
| A0A4Z0A339 | 3-166 | None |
| A0A4Y9ZK77 | 1-189 | None |
| A0A4Y9Z656 | 404-593 | None |
| A0A4Y9Z3V1 | 672-830 | None |
| A0A4Y9YZY2 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.