DPCstruct | MC46211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 228 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B1QCA4 | 1-232 | MDIPELYAEGRQDEYRALIARGATRDMCETFNLEWVPEQGIIAWADEALFQDFSGPAMKPGQLWKIHLGRRITLEDDDQEGSQFIEE… |
| A0A165Y9F9 | 1-215 | MCERYKLRFYHELGIIAWADDDLFETFTGDLMEGGDLWQICLGRRIQLDPDDFDGEDFMRGLIEESCLFPNAVTTEHGAWQTVLTRQ… |
| A0A0C9X9I8 | 159-410 | None |
| A0A4Y9ZZY9 | 498-742 | None |
| A0A4Y9ZF74 | 29-275 | None |
| A0A166SSZ7 | 1-199 | None |
| A0A4Q2D476 | 2-170 | None |
| A0A5E3XJ22 | 119-363 | None |
| A0A4Q2DY37 | 227-431 | None |
| A0A067MAT0 | 52-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.