DPCstruct | MC46209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 256 ± 37 aa |
| Standard deviation of domain lengths | 37.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165X4Y5 | 37-359 | SSHSAHPARPSAPSSHLPQHSSASVVAKVPLPVGYTAVVEWPERTALAVYNTAYCPPVPTLLLGGDIFIGEDHRWMTSEWTREPQLI… |
| A0A409YSP3 | 51-275 | IDSQIWEIWSPNSTACPFYPGLRDLSVDLEKDLPADRRRCDGHLGRFDPTVSPQYFEPERPWLGFIRRSVDESRPEDVPWLKEWQPT… |
| A0A284QSB4 | 39-292 | None |
| A0A4S8MPE9 | 237-511 | None |
| A0A146HNN1 | 37-280 | None |
| A0A4S8MMI9 | 19-284 | None |
| A0A0C9U9N2 | 17-295 | None |
| A0A284R0N3 | 6-275 | None |
| A0A137QVX3 | 11-302 | None |
| A0A165WQA7 | 1-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.