DPCstruct | MC4620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 203 ± 20 aa |
| Standard deviation of domain lengths | 19.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060TFL5 | 228-419 | PVVTSEGEIKGVRALFVQYAYETVVFPKIPLIYKCDYFVFRYIPPEFFVSLGRKSKPSLLSQFGEGAEYNGVQPKDMKFPPNAFPRS… |
| G3B8X8 | 41-224 | IRGIDSSGYTYLNQSAYHKFPVLSSNEYLQLKFFPGNHFISRIRKSNIALGNFNNPISLLNDPVLEKALKSYRGKYSESGFFNERSH… |
| A0A0J9XD41 | 56-313 | None |
| H2B0H7 | 11-230 | None |
| A0A2T0FGJ5 | 74-274 | None |
| A0A1E3QU27 | 3-190 | None |
| A0A0L0P4I8 | 1-198 | None |
| A0A1E4TTS8 | 122-327 | None |
| C5MD50 | 71-260 | None |
| A5DTZ5 | 79-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.