DPCstruct | MC46195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 182 ± 19 aa |
| Standard deviation of domain lengths | 18.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4MDB6 | 134-271 | VSELKKEAYQILKNLNAKGGCMITHPFRERKQKLLDGKTKSYWYPSIHFHVVGYGWLNYGLVVENFRKSGWIVKDKGERESNYGTIR… |
| X1PW97 | 2-217 | TFSPPKDQWGEYKSMRAAAYEVMEKAGVRGGCGIFHAYRFRDVNGESVAWKHCSLNPAAVYPIIQAEAFYSPHFHGLTAGFLMNSDR… |
| X1B5I2 | 1-187 | None |
| X1AKA2 | 22-219 | None |
| A0A564Q8R1 | 10-181 | None |
| A0A0H5Q1Y9 | 83-268 | None |
| A0A846NC09 | 17-198 | None |
| A0A2E4JP23 | 98-272 | None |
| X1R948 | 130-315 | None |
| M4YK32 | 245-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.