DPCstruct | MC46193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 51 ± 4 aa |
| Standard deviation of domain lengths | 3.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1PP16 | 1-48 | MKFLITGGAGFIGSHIVDELLFLGEEIIVIDNFNTYYDPKIKWVNISK |
| A0A5C7WEA2 | 1-46 | MKILVTGAAGLIGNYLSRQLVWRGDDVVGIDNFDPYYPRNCKEFNV |
| A0A127SNS7 | 11-62 | None |
| A0A0B7ID08 | 1-57 | None |
| X1EPH1 | 1-57 | None |
| A0A6N3DN90 | 3-52 | None |
| A0A2V9LVX9 | 2-49 | None |
| X1FW49 | 14-66 | None |
| F9ERD8 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.