DPCstruct | MC46192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 341 ± 54 aa |
| Standard deviation of domain lengths | 54.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3I6H7 | 59-323 | GEGNVILNEEGTFNNIYLASGNGKVILNKDNSLGNDQYAGIFFTKRGGTLDLNGHNQTFTRIAATDDGTTITNSDTTKEAVLAINNE… |
| A0A2N0W1K8 | 326-711 | DLRFNGEGGLIVLDSSVNHGAAKLQFSNDYRVISAEGANSTWVGGGVEVDAGKTVSWEVNGLAGDNLHKIGEGTLHVNATGVNGGGL… |
| A0A5V1IPY0 | 359-779 | None |
| A0A376W4I6 | 1-242 | None |
| A0A4U8UAY5 | 14-383 | None |
| N2BMW7 | 2-314 | None |
| A0A376KIR9 | 44-409 | None |
| A0A656BN70 | 371-738 | None |
| A0A5Z0YN40 | 283-653 | None |
| A0A376MGG4 | 1-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.