DPCstruct | MC46191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1HYR8 | 71-156 | LQYTARASYALEKAFGAPLGRACGIIVGAPASVGVLMADTALKSANVEVVAYSSPAHGTSFSNEAILVISGDSGAVRQAVISAREI |
| A0A6G3HQX0 | 2-106 | PALDLIRPSVTAMRVIASVNAEFARELKLPPHIRSLGLISADSDDVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIML… |
| A0A832PTY9 | 6-106 | None |
| F9MRZ8 | 6-99 | None |
| A0A1V5HGU7 | 156-247 | None |
| A0A7Z0XJN3 | 1-72 | None |
| A0A7C1P3C1 | 27-126 | None |
| A0A347WNV4 | 1-79 | None |
| A0A377XB82 | 1-92 | None |
| A0A2X3CPX3 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.