DPCstruct | MC4619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 198 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3B6L6 | 1-228 | MFSKSLKGLLVTAFSALLANAQDITSNTIDRGTISISLGNTHIYPDVYYSIIDVAVASFTGSFNNEGGFYLTSDSSLIALTASIVGT… |
| Q5AAL9 | 20-201 | AIDITENKVDRGSVTLSFGEIIIHPGASWSIIDNAFSNFIGKLDVKAKSALYISSTSHLLALQVSLTTLLHSINNSGIISFDSRVSL… |
| A0A421JD66 | 10-200 | None |
| H2B009 | 20-206 | None |
| A0A4Y5MUQ8 | 1-199 | None |
| M3JV22 | 1-202 | None |
| A0A1A0H1W6 | 1-201 | None |
| A5DYX2 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.