DPCstruct | MC46188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 289 |
|---|---|
| Mean domain length (aa) | 282 ± 72 aa |
| Standard deviation of domain lengths | 71.61 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.90 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0164- PF04385- PF01016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1LDX7 | 25-236 | ERSPIDLDIAYELPPQICVSISETHPNGRYFYLKKSIANRFRLGLITCADSVIFLGNEKDMLRFVFLQELDDGKRYMRIVSKLADYH… |
| L1LEB0 | 6-255 | GYSIQITKDQNYGMIYVESVSFGIYVRVTHEHSTSSFFIKSVKYYNHKLVDIKINADTYQKVNVYFWQGEPNRPIMVELINSYSISI… |
| L1LC01 | 166-536 | None |
| L1LCV0 | 8-369 | None |
| L1LCQ7 | 213-504 | None |
| L1LCM7 | 266-543 | None |
| L1LCX4 | 542-1016 | None |
| L1LC00 | 11-393 | None |
| L1LBJ8 | 7-272 | None |
| L1LBS6 | 1-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.