DPCstruct | MC46187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 174 ± 29 aa |
| Standard deviation of domain lengths | 28.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0B0S8 | 22-179 | AKKPVKEAPVRNVVKVDSSKSNIPERRRCDCNATEHPLYNNCVGCGRIICTVEGPGDCFQCKRLICPPGTTPPEFSDSQEFSRALFL… |
| E9ICD8 | 1-150 | RHKCNCEATRHALINNCLNCGRIVCVQEGSGPCFFCEELVCSSKEQALLQSNTKQGDNLYSKLMDQKPSKDFENSLKHRDKLLEFDR… |
| A0A3L8DUZ2 | 62-227 | None |
| A0A0N4W5H1 | 19-175 | None |
| A0A5B8MFN1 | 125-309 | None |
| A0A1E7FE58 | 128-291 | None |
| A0A6T7GQ22 | 178-339 | None |
| A0A7R9AA93 | 367-501 | None |
| A0A0G4H999 | 157-313 | None |
| A0A3Q0J8J1 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.