DPCstruct | MC46186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 198 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1LEI1 | 59-164 | RTPINVDILSQNSTNVIQVDDNFQYTAKRFRVRDEMTYRFTIGMVRYGTFLLSNKAQSLIDRRIIWEGGLERPFIKIISTLTYGERH… |
| L0AW34 | 25-141 | YKDQGGVAGPKIVKLNVNDIDTNLFSTEESFPEGVPLKTVTPKDGVLISSVMDGKMEVYTVPRDQVCYLCELHSEDGYKLLRIHSHK… |
| L1LDA7 | 11-122 | None |
| L1LD57 | 1-106 | None |
| L1LCX4 | 766-879 | None |
| L1LCQ7 | 315-489 | None |
| L1LC55 | 3-88 | None |
| L1LCM7 | 306-431 | None |
| L1LBU8 | 102-233 | None |
| L1LDF4 | 108-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.