DPCstruct | MC46182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 168 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 77.22 |
| Assigned Pfam label(s) | PF09582- PF01548- PF16916- PF02579- PF17253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9BII2 | 2-121 | RIGISSSTNGGLEDTIAPVFARAPVFTIVDVENGEIKNVKVLQNQAAYAGGGAGPIAVQALINEGVDTIIASQIGPNAMGAIQAAGI… |
| A0A1L9GYA7 | 3-107 | VAIPCNKEKMLVPLDQAELIVLYNDEDKSIVENENPGYGSKEATMSMVLREAPDVIAVKEGVMCPGSYMMSQGSIKYALVKSDSASD… |
| A0A7C3N560 | 1-86 | None |
| A0A4U0ZVF4 | 262-380 | None |
| A0A524I1T9 | 279-384 | None |
| A0A7C4L336 | 199-333 | None |
| A0A2N6FKA7 | 3-92 | None |
| C7N6Z8 | 137-254 | None |
| A0A7C1G543 | 202-296 | None |
| U6ECS4 | 34-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.