DPCstruct | MC46175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 291 ± 83 aa |
| Standard deviation of domain lengths | 83.02 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3AEF5 | 93-351 | LDQANEFNIKKVKVCDDESLFTINTRQITDTKVTELIRSLESIGQQQYQNFVEEQFVSRNKSVEDPIKHNGLAMFSTPVQAKQATKS… |
| A0A7D9K559 | 3-172 | ARMLVVASDKTELDVRKIISYPITTYPLSLAHCDGTHMKTEKSALLRKLESFQTETITETQLPMSYAQIYDGGLLLHSILSLTAVGA… |
| A0A4C1ZL94 | 196-462 | None |
| A0A5E4Q6P1 | 183-501 | None |
| R7TLJ6 | 587-894 | None |
| A0A4Y2PHS3 | 1-196 | None |
| A0A162C250 | 3-234 | None |
| A0A162PXG9 | 127-395 | None |
| A0A7E5VNS8 | 39-389 | None |
| A0A1Y1N804 | 2-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.