DPCstruct | MC46170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 160 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2ZXR5 | 1-193 | MHQLFSLVLGQRDLSRAGDLFSLQDADIEDSLSEALEQIKDISSSTDYLTNDNDQAVVEICITRITTAIRETQSIEKHGKALVALWE… |
| C4WWT1 | 1-120 | MHELFTQVLNYKDLSKAGDLFTISDDAIVNDLSEVINIICEITSFPDYVNNDNDQSVVEICITRVTTAIRETGSMEQHAEAMVTLLE… |
| A0A7J5YIA4 | 25-177 | None |
| A0A4U8UPR7 | 187-365 | None |
| A0A6H5HNA3 | 1-180 | None |
| A0A498M835 | 1-144 | None |
| A0A556TQG3 | 55-215 | None |
| A0A369RZ66 | 13-123 | None |
| A0A7F8RKU7 | 14-173 | None |
| A0A0V0SIH0 | 81-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.