DPCstruct | MC4617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 470 ± 87 aa |
| Standard deviation of domain lengths | 87.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.66 |
| Pfam Score | 90.51 |
| Assigned Pfam label(s) | CL0266- PF09135- PF03909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3B3Y2 | 72-535 | GANAGDLNISAEGSLSDQSLLKNHQLQQKLLLEDKNLRNLFTQSVINFKLSPTMFWSTRLSLLRTYALTVSQHRGRYNVLSTIKPVA… |
| A0A0L6WBM7 | 31-447 | IAQLHRDLVIAGQITEEEFWDGREHLLLAQAAADAQKKGKSGQLVDPRPEAVDGGEIKIRITPQLVHDIFDEYPVVAKAYSDNVPSN… |
| A0A842Z311 | 7-420 | None |
| K8EGP2 | 51-709 | None |
| A0A0D8XVV6 | 1-535 | None |
| K3YIH8 | 1-323 | None |
| A0A0G4MDV7 | 9-389 | None |
| A0A0V0XIC0 | 2-363 | None |
| A0A1R3IB59 | 24-471 | None |
| A0A7J6AFD4 | 112-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.