DPCstruct | MC46168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 159 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2ZT59 | 8-161 | FYQWSKAVQIRTNLDLVLDWLQGVGLGDIATEFFRKLSATVNLLCIHKTSLLQTSWSCLRGDCPSLTPAQLNHLLCNYQLGQGRPHP… |
| A0A401RLD6 | 656-810 | GSGGGFYQWTKGVQIRANLDLLLDWIQGIGLGEQAAELFLKLSTAVNLLATPKETLLQANWRSLRSDFFSLNPSQLHHMLREYNPGR… |
| A0A7I8VKA5 | 512-651 | None |
| H3C7S7 | 2-158 | None |
| A0A4Z2B051 | 45-178 | None |
| A0A1V4KXP2 | 22-179 | None |
| A0A672II13 | 136-311 | None |
| A0A1X7SIL7 | 4-154 | None |
| A0A6S7I6C2 | 888-1064 | None |
| A0A553MM42 | 298-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.