DPCstruct | MC46163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18972 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815IL27 | 1-128 | MRDRAAKLQKEKERDERKQQGRERKQKSEHDKVLNAIRQRNIHLQEDPSIDIFNINANPAGSCVQLNESNQLLTFPVVFLYPEYIQT… |
| Q23QZ8 | 263-370 | EKQIENERKRREKIQEHKNTQTLILHTELKKRKIYLGNQMMDFPDSCKKCVYLDDEKILHIPIFVHYPEFSQMDYIDDTREKDVLKD… |
| A0A7J8A306 | 111-265 | None |
| A0A3P7LZJ6 | 167-255 | None |
| A0A212F1P4 | 164-307 | None |
| A0A2I0T4F4 | 547-683 | None |
| A0A834AF04 | 655-809 | None |
| A0A7R8HCT2 | 149-269 | None |
| U3KCB1 | 405-558 | None |
| A0A818XFV8 | 259-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.