DPCstruct | MC46161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 16.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815GR82 | 12-148 | CLLFLSRFSTNKRYDVGLPNYIFENEHESINEHTIKKLSYKKEIALVYEWLYIHCSSFRSTCYIVTSIWSIGFLLEFLGRLTLILVR… |
| A0A820KR74 | 127-295 | FAITLIPFHCCHHRCSLRPVGYYMYQDLVPTNREDVGLPEHIFCDQQEQVDSRYTDLQEEVSSRKVFHKEEVVQVYDWIYKNCSSFR… |
| A0A815T7W7 | 1-111 | None |
| A0A815Q462 | 215-393 | None |
| A0A820ANA8 | 8-168 | None |
| A0A820VE53 | 2-166 | None |
| A0A818XWZ1 | 127-287 | None |
| A0A818F7W4 | 59-221 | None |
| A0A819UDR7 | 86-222 | None |
| A0A815BHB6 | 136-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.