DPCstruct | MC46160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 56.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815G5G2 | 1-85 | MTSETFTTNFLSNKGFFIKYGSNLFGLTGTLGSEKAKQVLVDIYNVHLGIIPSLRQKQYLSLPDLVLTNEVDWLNEICRSAINES |
| A0A820YGL0 | 1-101 | MTSETFTTKFLSNSGYFTKYGSNLFGFAGTLGSKQAKQVLADVYKVDLVIIPNSCQKQYLALPDIVAINDIDWLNEISCSAINESSE… |
| A0A820Y1R3 | 284-369 | None |
| A0A821TUG7 | 7-101 | None |
| A0A817PQJ5 | 147-233 | None |
| A0A815L0E6 | 197-295 | None |
| A0A816M2M5 | 442-540 | None |
| A0A818YKA6 | 146-227 | None |
| A0A818XU87 | 147-232 | None |
| A0A816CFN1 | 441-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.