DPCstruct | MC4616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 14.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0123- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3ZEM2 | 371-525 | IQEEQSIMSDTESEDPETFAVYLQRRIQPQPSNNSTLSISRFATQSAQKLRQSMKAIGLKPCRSKSQMIASLEAASQVLDSSCTELQ… |
| G3B1R4 | 1-151 | MVGQLIAKADRSVIQVPSSPDIGAVTLSQRNPSEFSQMSAKELRGVFKDWQLKPVKTKEKMIEILENASEIIDSQNPSQLTQTEFNE… |
| Q6FJQ6 | 586-726 | None |
| A0A1E4RIK9 | 581-749 | None |
| A0A2G5BGP6 | 543-715 | None |
| A0A397UPH4 | 114-280 | None |
| A0A0L0S7X4 | 519-657 | None |
| A0A1X7U8T2 | 470-645 | None |
| A0A1E4U1V2 | 759-935 | None |
| A0A1E3QR02 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.