DPCstruct | MC46158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 4.44 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1LZK1 | 88-174 | GEAEDYRSYWDSSWVDAQGNPIPGVAPAWLGPQNPDFAGNYKVRYWDPDWQALILGTLTGPNETPLDRIVDQGFDGVYLDIIDAYDF |
| A0A7V1PUG1 | 51-132 | ICYMSIGEAENYRYYWQPDWEVGNPSYIYKEDPNWPGNFYVRYWNPKWKEIIYGNENSYLKKILDAGFDGVYLDIIDAFEQF |
| A0A849Q752 | 66-147 | None |
| J5I4C5 | 269-354 | None |
| A0A7W3W944 | 73-164 | None |
| A0A7C5WM83 | 366-462 | None |
| A0A833D9I6 | 207-294 | None |
| A0A7V0TL99 | 246-333 | None |
| A0A7C5M1R8 | 173-256 | None |
| A0A524AEI5 | 117-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.