DPCstruct | MC46157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 85 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251WKL1 | 134-239 | MVELAQRIDRPIRLIYYPPYHSKYNAIERCWAALENYWNGAILDSVEAAVQWATNMTWKAVAPVVYLVEGLYEKGVQVFAEELESDL… |
| A0A7W1EC12 | 31-118 | SPSVRGTHKIEHRLFSYISRNWRGRSLVSYEVIINLIAATTTSTGLKVYARLDEQQYPKVEVSDEQLAAVNLVADAFHPEWNYTIKPS |
| T1B5Y4 | 8-77 | None |
| A0A7Z8VQE7 | 1-90 | None |
| A0A653EYM2 | 7-101 | None |
| G2E8R7 | 47-107 | None |
| A0A849QSU6 | 587-678 | None |
| A0A1V1NVL3 | 397-493 | None |
| A0A1F3KSR6 | 20-78 | None |
| A0A5C8KDS3 | 178-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.