DPCstruct | MC46156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 163 ± 48 aa |
| Standard deviation of domain lengths | 47.77 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 89.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.52 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF01887- PF20257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1BGV6 | 33-186 | LFTFVLRDAEVLIVSLPTPADASATFHGRDLFAPAAAALAGGQRLAVLGEPFAAMPARLVYAEPHYEGKSVVGQVVYVDRFGTLITN… |
| A0A660R4Q2 | 65-262 | AVVDHGVGTARKSIVMRTKNNMFFVGPDNGIFTLVAEEYGVKEIREITNRKLYYKKDPSFTFHGRDIFAPAAAHLDKGTPMESLGTR… |
| A0A7C4E0B3 | 23-162 | None |
| A0A1G2YN18 | 3-118 | None |
| A0A7V2XG15 | 403-600 | None |
| A0A7V2UDW7 | 90-294 | None |
| A0A258QTB1 | 28-164 | None |
| A0A3L7WDB8 | 2-93 | None |
| A0A1I4DID5 | 20-163 | None |
| A0A2N3ZBX3 | 241-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.