DPCstruct | MC46152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8Z2Z4 | 15-127 | TNVPSKLKSKPLFERDAKKLVDIVLPLGTNGIARLMSISENLATLNFERLQNFRGTKKIKQAVFAFNGDVYEGLNVKTFSEKDLIFS… |
| A0A6H9WM26 | 41-168 | SASLSWPSMGSVRDELVGDLVALAGDAERMAAAFKLSDKLAAVEAERNRALRTAPRLPAVLRYTGVLYDALDAGSLDAEACRWLAGH… |
| A0A6S6S027 | 1-112 | None |
| K1LE05 | 13-119 | None |
| A0A3D4VTC0 | 39-151 | None |
| A0A4Y9IUA2 | 9-144 | None |
| A0A6G3VIR3 | 2-113 | None |
| A0A378CFB4 | 305-445 | None |
| A0A4Y9FDX1 | 238-367 | None |
| A0A5C9BTB2 | 12-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.