DPCstruct | MC4615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7FC91 | 48-160 | FSAALAQEEARLSAEYPKSEDIPTCMSHLDEFFRCHALGPQFKAVYRHGTLAVCQPKFEEFKFCLSIKMLEPEERRKAWIRRRAEWW… |
| G3AYY9 | 16-144 | KDSPDDIKEKRQKLTASLSRTDLGAYPSTMSISTAFDELFQCFSIGGQIKNYYRYGELSYCGKQREKLWFALRHGSFVSETQVNEQS… |
| A0A517LGZ9 | 82-184 | None |
| A0A0G2F4C0 | 1-101 | None |
| A0A0F4YF77 | 52-192 | None |
| R7TH32 | 1-110 | None |
| A0A177VVC8 | 24-146 | None |
| A0A177UG92 | 24-129 | None |
| A0A5J4YQD3 | 2-106 | None |
| A0A4P9Y560 | 10-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.