DPCstruct | MC46143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7WYH3 | 18-124 | SIFSKPSNSGLPLCPNPPPFLVGPIPTWMDGPNMNKLEQLYSNNVEIGGHGVPKECISRHRVAIIVPYRDREQHLRIFLHNMHSILQ… |
| A0A158QRM7 | 2-75 | EEIPLKQLEEKFKYLKPGGHYIPNGCKPLNRVAIIIPFRDRESNLHILLNNMHPFLTKQMLDYLIIVVEQVTNQ |
| A0A1S3ITD2 | 9-76 | None |
| K1PYH7 | 19-118 | None |
| A0A4Z2EJQ4 | 10-96 | None |
| A0A643BY39 | 48-170 | None |
| A0A1S3J6N6 | 99-197 | None |
| A0A5N4DAX2 | 68-191 | None |
| A0A4Y2TFV4 | 44-146 | None |
| A0A3Q4HUJ8 | 64-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.