DPCstruct | MC46140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 409 ± 66 aa |
| Standard deviation of domain lengths | 66.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DNG3 | 47-407 | GGMYSEWASLSALIQNGCDESQSVLGKLPMSAGREVALSVVKQLASNLGIVQPAESSPLDSDRDVQWCMEVICFGLSLPLSEHDTIR… |
| A0A6V7WRC4 | 15-412 | TEPKFGILSQFTSSASEAVAHILVKELVEKVDKPLSTSSSQDDAFSTDSDLDWIMQVTNHSLTLPFIPNQCYETLRSAVRIYIAWSS… |
| A2DVW0 | 17-386 | None |
| A0A0N5AU91 | 20-278 | None |
| A0A6A4WM90 | 1-499 | None |
| A0A815SA26 | 205-696 | None |
| A0A132AL75 | 3-469 | None |
| A0A286Y9P2 | 5-452 | None |
| F4PCW7 | 1-427 | None |
| A2F9A1 | 10-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.