DPCstruct | MC46132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8WR40 | 12-103 | LIPFSEQINAKRFRKFDKVKLDDEGYKKVHNLHVNWYITSIKALMGELGKDLYKKLDYVERRRLERCLYKIENKMDLVRSAQCLTKS… |
| A0A0N4WT59 | 4-90 | RDFDKVKLDKEGYEKVRAIHYNWYLHSMKAIMGQLGKDVLPKLSPSNRRQFLRCLDGIVDKRDLVSAARCLIEAKEKLDSDKVQCSK |
| A0A0K0ER90 | 1-105 | None |
| A0A4U5MQ04 | 19-108 | None |
| A0A1I7WRD2 | 1-105 | None |
| A0A3P7EN26 | 7-112 | None |
| A0A1I7ZJL8 | 43-120 | None |
| A0A0N4YM49 | 1-106 | None |
| A0A0C2GHP0 | 57-143 | None |
| A0A158PCN6 | 84-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.