DPCstruct | MC46131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Standard deviation of domain lengths | 16.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0027- CL0028- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7YB56 | 1-123 | MDPKALDKLLKAQQEYFEKLLVNLLKPSEMNETELYSKLVGMIGEFSFDLTSGMTFESWLGRHRSYFEEEGKTLPESSRVRLLLSKL… |
| A0A6V7W8P4 | 4-111 | KVLEKLLKAQQEHFEKMLVRLLKPSEMNDTELYSKLVAMIGEFSFDLTSGMTFESWLGRHRSYFEEEGKTLPESSKVRLLLSKLGPE… |
| A0A0D6LRJ7 | 34-148 | None |
| A0A0R3URS8 | 22-118 | None |
| A0A654I3V2 | 31-128 | None |
| A0A7M3RU93 | 1-114 | None |
| A0A6A5DKK1 | 499-611 | None |
| A0A654GSE1 | 17-130 | None |
| A0A183TSX5 | 6-97 | None |
| A0A016TMX6 | 70-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.