DPCstruct | MC46130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7W8G8 | 1-98 | MPSDWKAFKRDWKKGKYLECTPLLERPKNTSRKIPIKFLDRLVEFSNLLDKHNATAFLMGGTLLGWARECSLIPHTTDTDLGMFSEE… |
| A0A0D8Y9L8 | 40-152 | RISFQIHGNLSIPSDIGRFFEFWKRSILMHCRSLTVVRSEQTRYLPLEKTLEAMSSFMSYLIEFDIYPILFGGTLLGWYRECDIIPH… |
| A0A1I7WC90 | 74-183 | None |
| A0A6V7XCN5 | 95-191 | None |
| A0A4U5PG97 | 172-268 | None |
| A0A816DDX6 | 179-276 | None |
| A0A3P6UGI0 | 104-220 | None |
| A0A0K0DKD5 | 97-191 | None |
| A0A2G5VGN9 | 105-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.