DPCstruct | MC4613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4K5T2 | 162-214 | CPTNLSQYPFTQCYYKDSLKESSGGCYRIRNIPLDDRLIFMDANLTQNCSKAE |
| A0A238BPW0 | 1-61 | MNYSIKLCPTKLSEYNFTENCYYNDANLRDEGGCYSIRDVPLDDRLILIDTYLTQKCDCLK |
| A0A0R3QW55 | 67-123 | None |
| A0A4U5N3J0 | 446-500 | None |
| A0A183UM03 | 641-710 | None |
| A0A0R3RQE7 | 1-64 | None |
| A0A0M3HYS7 | 105-166 | None |
| A0A182E9D4 | 5-64 | None |
| A0A183E3P0 | 52-102 | None |
| A0A498S5B4 | 998-1061 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.