DPCstruct | MC46126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388Q4P8 | 9-119 | VAGKETAAFLEEKLAYLGLNRKEANEFIMYWLPRMEDNPYNLIHFASEQYEEQAKLVIVPKPDCRIRVMMLTQPLNARIDLPLQELS… |
| A0A3D0VQE8 | 177-281 | ITRANLKSFFEENMSMYNFSQQEIKDFTDYWISLLIEDNYYNIYPQTNAIIDTAIQLDFSVQPDNVGRLFYGIVGVNKYQQIDQPMV… |
| A0A6A4H362 | 94-252 | None |
| A0A0C9UDY5 | 215-328 | None |
| K2D870 | 9-110 | None |
| A0A1G5E147 | 200-301 | None |
| B0EU79 | 322-434 | None |
| F8C5E2 | 280-389 | None |
| A0A1F5ZT20 | 368-483 | None |
| A0A2U8DPV7 | 240-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.