DPCstruct | MC46123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388Q0Q7 | 3-90 | GGKYTLWSGDVNSNKNIKYNGLSNDKDLILTGLGGVSFINASLNMAYRHEDLNLDGKIRFNNTDNDRVIILNNIGTLTPNTIIHQHTP |
| A0A7Y1Z5V8 | 156-259 | AQVQLASGEMALWTGDTNGANQIRFSGSGNGTNIIKDHVLADPANGFDSVTFSSMGYLNIDLNLDGIGRFSGSGNDSNIIKDNVLAY… |
| A0A7L4ZPV7 | 1162-1270 | None |
| A0A2G2KGJ8 | 1073-1182 | None |
| A0A388Q2T1 | 16-125 | None |
| A0A7Y9MBX7 | 201-304 | None |
| A0A388Q6N4 | 627-722 | None |
| A0A3C1T9K8 | 359-463 | None |
| A0A345GVG7 | 1002-1110 | None |
| A0A7T9KND5 | 236-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.