DPCstruct | MC46118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 3 aa |
| Standard deviation of domain lengths | 3.11 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9TGD9 | 7-85 | EETSLEDMIVDLILDGQWEVLQPNSGKSIVLGNGKSVSVSYQEEPGSGYRTWEWHGHVMVYEDGEGYVPEYVYGNYFEP |
| A9T9V9 | 41-117 | SALSDKIIEIITSGNWESLQPNSGNSVEVGDHQVCVFYDVKSSGEYRTWEWQGHIIFFNEEEMMYVPEYVYGNYFEP |
| A0A443PUS0 | 64-145 | None |
| A0A443NT02 | 105-187 | None |
| A0A443NAZ5 | 69-146 | None |
| M1ARB0 | 73-155 | None |
| R7W5T6 | 2-82 | None |
| A0A5D3DN52 | 67-144 | None |
| A0A3L6TV66 | 99-177 | None |
| A9P034 | 49-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.