DPCstruct | MC46117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9TEY9 | 5-98 | NFRKPRSWKHTEAITRAQLKQMRDEFWDTALHYGGQKEIWDALRAAAGAEINLAQLIVDSAGIIVQSEDLSTCYDERGAKYDLPTYV… |
| A0A4S4EAM6 | 101-196 | KKVRKPKPWKHSEPITRAQLKQLREEFWDTAPHYGGRKEIWDALRAAAEADLTLAQAIVDSAGVIVQAPDLTICYDERGAKYELPKF… |
| A0A4D9B9X7 | 341-458 | None |
| A0A0M9VWX3 | 77-212 | None |
| A0A2U1QJS8 | 19-121 | None |
| A0A438NBM7 | 392-523 | None |
| A0A835Q0K6 | 830-940 | None |
| A0A812DG17 | 99-196 | None |
| A0A2S7PAH3 | 2-97 | None |
| D8M7J4 | 5-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.