DPCstruct | MC46116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 104 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF16627- PF08381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9TCA8 | 6-94 | SEHSESVTCTERATETDTVAGSEAGSDRTFDGEETTWVEEDVPGVYLTLKNLAGGGRELKRVRFSREKFTEKQAKLWWDENRGRIHK… |
| A0A444XGP5 | 269-351 | LDASARTSSLGEGDHSGELSNSNASDMETEWVEQDEPGVYITIRALPGGARELRRVRFSRERFGEMHARLWWEENRARIQEQY |
| A0A4S4F389 | 117-218 | None |
| A0A5P1EW64 | 245-364 | None |
| A0A6A4PPL0 | 58-171 | None |
| A0A6A6L0G4 | 73-150 | None |
| A0A164X9S2 | 118-269 | None |
| A0A1U7YG36 | 71-171 | None |
| M8A937 | 1-99 | None |
| A0A4D9BP91 | 352-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.