DPCstruct | MC46114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7M3V3 | 4-106 | TRGSKFRCGKCRHVLFFGEHLVTHKRCDGKNCEFGYLIEPMKWMDVSEYEGKVNCPSCKIKLGNYSWGGRQCHGEPGAKCVQHVTPW… |
| A9TA70 | 7-111 | KRVVACQENVIPHEPVSGESSFRWRRRDVRRWGGEHDDPACTSIFVEPMQWMNLDGDGLHEGKLQCLNCESRLGSFNWAGIPCSCGK… |
| A0A066WH32 | 614-719 | None |
| A0A1Q9CM14 | 310-433 | None |
| A0A7R9A4U4 | 309-422 | None |
| A0A7M5V1Q0 | 1-109 | None |
| A0A7S2UFE6 | 211-360 | None |
| A0A7R9KBM9 | 207-310 | None |
| A0A6D2K065 | 45-169 | None |
| A0A5D3D5C3 | 521-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.