DPCstruct | MC46102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 183 ± 18 aa |
| Standard deviation of domain lengths | 17.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8WSV6 | 3-192 | GDPVIFVPNRDQLWATGKYNEAGITAMLTHGKESHFEQGHSLSPNLYAHTDGKWQLYVPEEQELRKLALSVKRQRDGIDYAQQKNYL… |
| A0A081HXI2 | 131-320 | GPRPLVFFPGDGSLVLGTDAPDQVAELFEVAEQLYLEAEQPVSPQGYTIAGAIIVPFDQAGPHPLRGYGLAARSLLAAREYQHQTDY… |
| A0A536D5Y6 | 347-526 | None |
| A0A1V5QZW4 | 179-354 | None |
| A0A386ZAF1 | 1-186 | None |
| A0A1H9PKI2 | 81-267 | None |
| A0A0F2C7R7 | 11-156 | None |
| A0A849FRX1 | 38-235 | None |
| A0A516NHE1 | 32-220 | None |
| W1VPN2 | 44-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.