DPCstruct | MC4610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 231 ± 18 aa |
| Standard deviation of domain lengths | 18.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9F3Y0 | 138-390 | SINTVEEVYQRVLQLWLLLLLTYFGKIGGFTLMKNFLERNVNETTKITDFIDWLRPFASCSLLLKPSIIIETFGPTIQIAVARLEHM… |
| A0A238BLP9 | 1-264 | MLYTSINTVEEVHQRVLQLWLLLLLSYFGKIGGFTLMKNFLERNVNETTKITDFIDWLRPFASCALLLKPALITETFGPTIQMAITR… |
| A0A814MB30 | 96-306 | None |
| A0A132AFI7 | 2-225 | None |
| A0A1I7WZ48 | 34-264 | None |
| A0A6J8ENW6 | 25-258 | None |
| A0A818CFT4 | 223-476 | None |
| A0A819JKZ3 | 192-414 | None |
| A0A060XZY3 | 1-245 | None |
| A0A811WCI9 | 282-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.