DPCstruct | MC4609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 328 |
|---|---|
| Mean domain length (aa) | 74 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 99.74 |
| Assigned Pfam label(s) | CL0155- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182WD64 | 136-195 | VDARCPRADDPMKPVHLAVNGNCGKFMKCFGGRAYEMDCPAGLEFGSKVNRCDYPALAQC |
| A0A183I8B9 | 5-68 | TSAVKPTRKPNLRCPEPYGIFEHPTDCHSFMHCAHNIPYVMRCPPTTFFNDEIKVCDHMWNAPN |
| A0A0L0JJE3 | 7-90 | None |
| A0A7R9B073 | 108-181 | None |
| A0A395H9B1 | 9-101 | None |
| A0A4Y2CSN4 | 24-87 | None |
| A0A0N5CZ75 | 1-60 | None |
| A0A0N5CT03 | 102-177 | None |
| A0A0N5CPM8 | 33-84 | None |
| A0A818W3Q3 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.